Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOVL7 Human Gene Knockout Kit (CRISPR)
KN417151 1 Kit

ELOVL7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polr2e (BC026842) Mouse Tagged ORF Clone
MG201273 10 µg

Polr2e (BC026842) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NDUFA9 (NM_005002) Human Over-expression Lysate
LC401557 20 µg

NDUFA9 (NM_005002) Human Over-expression Lysate

Sign In for Pricing
View Details
Genistein 4'-b-D-glucopyranoside
TRC-G349975-1G 1 g

Genistein 4'-b-D-glucopyranoside

Sign In for Pricing
View Details
IGF1 Mouse Monoclonal Antibody [Clone ID: OTI3A6]
CF805792 100 µg

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI3A6]

Sign In for Pricing
View Details
Arfgap1 Mouse Gene Knockout Kit (CRISPR)
KN501475 1 Kit

Arfgap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details