Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV766522 1.0 µg DNA

LAMP1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TOP1 Antibody (N-term)
AM2253a 400 µL

TOP1 Antibody (N-term)

Sign In for Pricing
View Details
Human Hyaluronoglucosaminidase 2 (HYAL2) ELISA Kit
201-12-2750 96 Tests

Human Hyaluronoglucosaminidase 2 (HYAL2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Meprin beta Subunit/MEP1B Antibody [Alexa Fluor 700]
NBP2-99024AF700 0.1 mL

Rabbit Polyclonal Meprin beta Subunit/MEP1B Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC21 Antibody
NBP2-57201-25ul 25 µL

Rabbit Polyclonal ZDHHC21 Antibody

Sign In for Pricing
View Details
GENLISA™ Canine Haptoglobulin (HP) ELISA
KLN0431 1x 96 Well

GENLISA™ Canine Haptoglobulin (HP) ELISA

Sign In for Pricing
View Details