Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A)

This Recombinant Human Late cornified envelope protein 7A (LCE7A) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat COL3A1 Protein, His (Fc)-Avi-tagged
COL3A1-1179R 50 µg

Recombinant Rat COL3A1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
COPS7A ORF Vector (Human) (pORF)
ORF002568 1.0 µg DNA

COPS7A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
KD-Validated Anti-DDT Mouse Monoclonal Antibody
AGI1487-100 100 µL

KD-Validated Anti-DDT Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human LRTM2 Knockout A549 cell line
GTR15416060 1 Vial

Human LRTM2 Knockout A549 cell line

Sign In for Pricing
View Details
ZNF740 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51802061 1.0 µg DNA

ZNF740 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MVP AAV siRNA Pooled Vector
31182161 1.0 µg

MVP AAV siRNA Pooled Vector

Sign In for Pricing
View Details