Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein ZNF516-DT (ZNFDT)

This Recombinant Human Putative uncharacterized protein ZNF516-DT (ZNFDT) spans the amino acid sequence from region 1-163. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein ZNF516-DT; ZNF516 divergent transcript; ZNF516-DT C18orf65

UniProt

Q6ZTR6

Expression Region

1-163

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRVPPAGTWALRPIWTEMGTPLRGSQAPGRIVLLLLVITPQWRWIPSKTPNVAPRSNQRCNPGGYLSGGVSLCASHSQPAALPNLGRLQKKLLQTRCKGRRMCPKAGDQTGGAFCMCDVSGGGGECVSGSGGGGESGRKTGTTSAMKDPRVLKCKLRVTNDLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human VEGFB Antibody (SAA0448), FITC
FHE70311 100 Tests

Anti-Human VEGFB Antibody (SAA0448), FITC

Sign In for Pricing
View Details
N-Benzyl-3,4-dma hydrochloride
CAA98007-01 10 mg

N-Benzyl-3,4-dma hydrochloride

Sign In for Pricing
View Details
N-Benzyl-3,4-dma hydrochloride
CAA98007-02 25 mg

N-Benzyl-3,4-dma hydrochloride

Sign In for Pricing
View Details
N-Benzyl-3,4-dma hydrochloride
CAA98007-03 50 mg

N-Benzyl-3,4-dma hydrochloride

Sign In for Pricing
View Details
FITC Goat Anti-Rabbit IgG (H+L) (ASG029N)
ASG029N-01 Inquire

FITC Goat Anti-Rabbit IgG (H+L) (ASG029N)

Sign In for Pricing
View Details
FITC Goat Anti-Rabbit IgG (H+L) (ASG029N)
ASG029N-02 500 µL

FITC Goat Anti-Rabbit IgG (H+L) (ASG029N)

Sign In for Pricing
View Details