Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18 (NM_000979) Human Over-expression Lysate
LC424425 20 µg

RPL18 (NM_000979) Human Over-expression Lysate

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-01 50 μL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-02 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-03 1 mL

CTLA4 Antibody

Sign In for Pricing
View Details
ASK1 (MAP3K5) pSer966 Rabbit Polyclonal Antibody
AP02456PU-N 100 µL

ASK1 (MAP3K5) pSer966 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI5A11]
CF806868 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

Sign In for Pricing
View Details