Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Extended synaptotagmin-3 (ESYT3), partial, Biotinylated

This Recombinant Human Extended synaptotagmin-3 (ESYT3), partial, Biotinylated spans the amino acid sequence from region 114-291. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Extended synaptotagmin-3; E-Syt3; Chr3Syt; ESYT3 FAM62C

UniProt

A0FGR9

Expression Region

114-291

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVERVEWANKIISQTWPYLSMIMESKFREKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTNTCNRRRVTVDLQICYIGDCEISVELQKIQAGVNGIQLQGTLRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHLVLPNRVTVPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL
BNC402078-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL
BNC682550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL
BNUB0391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL
BNC740393-500 1x 500 µL

Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details