Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 22 (SIM22), partial, Biotinylated

This Recombinant Human Small integral membrane protein 22 (SIM22), partial, Biotinylated spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 22; Cancer-associated small integral membrane open reading frame 1; SMIM22 CASIMO1

UniProt

K7EJ46

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Crybb3 shRNA (UAS) - Lentiviral mouse Crybb3 shRNA (UAS, iRFP) plasmid
GTR15295255 1 Vial

Lentiviral mouse Crybb3 shRNA (UAS) - Lentiviral mouse Crybb3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
AZD1208 HCl 10mg
A16927-10 10 mg

AZD1208 HCl 10mg

Sign In for Pricing
View Details
COX7AP2 AAV siRNA Pooled Vector
55892161 1.0 µg

COX7AP2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SNAP25 Antibody
R30373 100 µg

SNAP25 Antibody

Sign In for Pricing
View Details
Human MARCH1 knockout cell line
ABC-KH9025 1 Vial

Human MARCH1 knockout cell line

Sign In for Pricing
View Details
MIR3916 Human qPCR Primer Pair (MI0016422)
HP300893 200 Reactions

MIR3916 Human qPCR Primer Pair (MI0016422)

Sign In for Pricing
View Details