Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated

This Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated spans the amino acid sequence from region 1-400. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2'-5'-oligoadenylate synthase 1; (2-5'oligo (A; synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS; OAS1 OIAS

UniProt

P00973

Expression Region

1-400

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Topoisomerase I, MT (TOP1MT/488), CF640R conjugate, 0.1mg/mL
BNC400488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diclofenac-13C6 Sodium Salt (may contain up to 3% unlabelled)
TRC-D436453-5MG 5 mg

Diclofenac-13C6 Sodium Salt (may contain up to 3% unlabelled)

Sign In for Pricing
View Details
Propargylamine, Hydrochloride
TRC-P762525-5G 5 g

Propargylamine, Hydrochloride

Sign In for Pricing
View Details
ITGB6 (NM_000888) Human Recombinant Protein
TP317387L 1 mg

ITGB6 (NM_000888) Human Recombinant Protein

Sign In for Pricing
View Details
GLI2 Rabbit Polyclonal Antibody
TA371696 100 µL

GLI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PCDHGA4 activation kit by CRISPRa
GA111109 1 Kit

Human PCDHGA4 activation kit by CRISPRa

Sign In for Pricing
View Details