Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-C (CYTC), Biotinylated

This Recombinant Human Cystatin-C (CYTC), Biotinylated spans the amino acid sequence from region 27-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-C; Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin; CST3

UniProt

P01034

Expression Region

27-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluocinolone Acetonide Impurity 30
RM-F122930-01 10 mg

Fluocinolone Acetonide Impurity 30

Sign In for Pricing
View Details
Fluocinolone Acetonide Impurity 30
RM-F122930-02 100 mg

Fluocinolone Acetonide Impurity 30

Sign In for Pricing
View Details
Fluocinolone Acetonide Impurity 30
RM-F122930-03 25 mg

Fluocinolone Acetonide Impurity 30

Sign In for Pricing
View Details
Fluocinolone Acetonide Impurity 30
RM-F122930-04 50 mg

Fluocinolone Acetonide Impurity 30

Sign In for Pricing
View Details
CD335 Antibody
GWB-579947 0.2 mg

CD335 Antibody

Sign In for Pricing
View Details
CPXCR1 Antibody - N-terminal region : FITC (ARP39742_T100-FITC)
ARP39742_T100-FITC 100 µL

CPXCR1 Antibody - N-terminal region : FITC (ARP39742_T100-FITC)

Sign In for Pricing
View Details