Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-opiomelanocortin (COLI), partial, Biotinylated

This Recombinant Human Pro-opiomelanocortin (COLI), partial, Biotinylated spans the amino acid sequence from region 237-267. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-opiomelanocortin; POMC; Corticotropin-lipotropin; [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH; Potential peptide; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha; Corticotropin-like intermediary peptide; CLIP; Lipotropin beta; Beta-LPH; Lipotropin gamma; Gamma-LPH; Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta; Beta-endorphin; Met-enkephalin] POMC

UniProt

P01189

Expression Region

237-267

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Niemann Pick C1 protein (NPC1) ELISA Kit
GTR10333750 96 Well

Guinea Pig Niemann Pick C1 protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RP-A p32 (C-His)
BP2747-500ug 500 µg

Recombinant Human RP-A p32 (C-His)

Sign In for Pricing
View Details
Anti-Human CD40-PE conjugate
CD40P-100 100 Tests

Anti-Human CD40-PE conjugate

Sign In for Pricing
View Details
CD79B Antibody
orb192476-01 50 μL

CD79B Antibody

Sign In for Pricing
View Details
CD79B Antibody
orb192476-02 100 µL

CD79B Antibody

Sign In for Pricing
View Details
Human IgE (SUS-11) protein, Na-azide free
0911-1-100 1 mg

Human IgE (SUS-11) protein, Na-azide free

Sign In for Pricing
View Details