Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GLPA), partial, Biotinylated

This Recombinant Human Glycophorin-A (GLPA), partial, Biotinylated spans the amino acid sequence from region 20-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS

UniProt

P02724

Expression Region

20-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AH3960
BA9193-50 50 mg

AH3960

Sign In for Pricing
View Details
Recombinant Pig Fibroblast growth factor (FGF2), Partial
orb2986654-01 20 µg

Recombinant Pig Fibroblast growth factor (FGF2), Partial

Sign In for Pricing
View Details
Recombinant Pig Fibroblast growth factor (FGF2), Partial
orb2986654-02 100 µg

Recombinant Pig Fibroblast growth factor (FGF2), Partial

Sign In for Pricing
View Details
Recombinant Pig Fibroblast growth factor (FGF2), Partial
orb2986654-03 1 mg

Recombinant Pig Fibroblast growth factor (FGF2), Partial

Sign In for Pricing
View Details
Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein omcB (omcB), partial
MBS1149397-01 0.02 mg (E-Coli)

Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein omcB (omcB), partial

Sign In for Pricing
View Details
Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein omcB (omcB), partial
MBS1149397-02 0.1 mg (E-Coli)

Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein omcB (omcB), partial

Sign In for Pricing
View Details