Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein AMBP (AMBP), partial, Biotinylated

This Recombinant Human Protein AMBP (AMBP), partial, Biotinylated spans the amino acid sequence from region 20-203. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein AMBP; Protein HC; [Cleaved into: Alpha-1-microglobulin; EC 1.6.2.-; Alpha-1 microglycoprotein; Complex-forming glycoprotein heterogeneous in charge; Inter-alpha-trypsin inhibitor light chain; ITI-LC; Bikunin; EDC1; HI-30; Uronic-acid-rich protein; Trypstatin] AMBP HCP ITIL

UniProt

P02760

Expression Region

20-203

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Spexin (C12orf39) ELISA Kit
YLA1034HU-01 48 Tests

Human Spexin (C12orf39) ELISA Kit

Sign In for Pricing
View Details
Human Spexin (C12orf39) ELISA Kit
YLA1034HU-02 96 Tests

Human Spexin (C12orf39) ELISA Kit

Sign In for Pricing
View Details
(R) - (+) -Canadine
166125 100 mg

(R) - (+) -Canadine

Sign In for Pricing
View Details
Porcine Irisin ELISA Kit
MBS2600139-01 48 Well

Porcine Irisin ELISA Kit

Sign In for Pricing
View Details
Porcine Irisin ELISA Kit
MBS2600139-02 96 Well

Porcine Irisin ELISA Kit

Sign In for Pricing
View Details
Porcine Irisin ELISA Kit
MBS2600139-03 5x 96 Well

Porcine Irisin ELISA Kit

Sign In for Pricing
View Details