Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein AMBP (AMBP), partial, Biotinylated

This Recombinant Human Protein AMBP (AMBP), partial, Biotinylated spans the amino acid sequence from region 20-203. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein AMBP; Protein HC; [Cleaved into: Alpha-1-microglobulin; EC 1.6.2.-; Alpha-1 microglycoprotein; Complex-forming glycoprotein heterogeneous in charge; Inter-alpha-trypsin inhibitor light chain; ITI-LC; Bikunin; EDC1; HI-30; Uronic-acid-rich protein; Trypstatin] AMBP HCP ITIL

UniProt

P02760

Expression Region

20-203

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPE (H-6) : m-IgG1 BP-HRP Bundle
sc-544138 1 Kit

CPE (H-6) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
CD68 Monoclonal Antibody
E53M01907 100 µL

CD68 Monoclonal Antibody

Sign In for Pricing
View Details
Rbp4 3'UTR GFP Stable Cell Line
TU267411 1.0 mL

Rbp4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human DNTTIP1 AssayLite™ Antibody (APC Conjugate)
32640-05161 5x 30 µg

Human DNTTIP1 AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]
HA601285 100 µL

Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]

Sign In for Pricing
View Details
Streptavidin-AP
AR2308 1 Vial

Streptavidin-AP

Sign In for Pricing
View Details