Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-B (S100B), Biotinylated

This Recombinant Human Protein S100-B (S100B), Biotinylated spans the amino acid sequence from region 2-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B

UniProt

P04271

Expression Region

2-92

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GTF2H3 Protein Lysate
MBS8412667-01 0.02 mg

Human GTF2H3 Protein Lysate

Sign In for Pricing
View Details
Human GTF2H3 Protein Lysate
MBS8412667-02 5x 0.02 mg

Human GTF2H3 Protein Lysate

Sign In for Pricing
View Details
MYT1L Rabbit Polyclonal Antibody (Carrier-free)
orb3099538 100 µg

MYT1L Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Human GATA-1 MAb (Clone 234732)
MAB1779 100 µg

Human GATA-1 MAb (Clone 234732)

Sign In for Pricing
View Details
F-Box/LRR-Repeat Protein 12 (FBXL12) Antibody
abx431900 200 µL

F-Box/LRR-Repeat Protein 12 (FBXL12) Antibody

Sign In for Pricing
View Details
VR23
MBS579532 Inquire

VR23

Sign In for Pricing
View Details