Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin alpha chain (INHA), Biotinylated

This Recombinant Human Inhibin alpha chain (INHA), Biotinylated spans the amino acid sequence from region 233-366. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inhibin alpha chain INHA

UniProt

P05111

Expression Region

233-366

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1305679 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38946116 3x 1.0 µg

RGD1305679 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
VIRMA (NM_183009) Human Over-expression Lysate
LS025962-20ug 20 µg

VIRMA (NM_183009) Human Over-expression Lysate

Sign In for Pricing
View Details
SPG3A (ATL1) Human shRNA Plasmid Kit (Locus ID 51062)
TR301415 1 Kit

SPG3A (ATL1) Human shRNA Plasmid Kit (Locus ID 51062)

Sign In for Pricing
View Details
HEY1 ORF Vector (Human) (pORF)
23227011 1.0 µg DNA

HEY1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human Dual specificity protein phosphatase 2 (DUSP2), Biotinylated
orb3006277-01 20 µg

Recombinant Human Dual specificity protein phosphatase 2 (DUSP2), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Dual specificity protein phosphatase 2 (DUSP2), Biotinylated
orb3006277-02 100 µg

Recombinant Human Dual specificity protein phosphatase 2 (DUSP2), Biotinylated

Sign In for Pricing
View Details