Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Progesterone receptor (PRGR), partial, Biotinylated

This Recombinant Human Progesterone receptor (PRGR), partial, Biotinylated spans the amino acid sequence from region 679-913. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Progesterone receptor; PR; Nuclear receptor subfamily 3 group C member 3; PGR NR3C3

UniProt

P06401

Expression Region

679-913

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin, Smooth Muscle Heavy Chain (ID8), CF640R conjugate, 0.1mg/mL
BNC400920-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (ID8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sufu Mouse Gene Knockout Kit (CRISPR)
KN516953 1 Kit

Sufu Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D,L-Mevalonic Acid Lactone
TRC-M339025-1G 1 g

D,L-Mevalonic Acid Lactone

Sign In for Pricing
View Details
Human WDR9 (BRWD1) activation kit by CRISPRa
GA110049 1 Kit

Human WDR9 (BRWD1) activation kit by CRISPRa

Sign In for Pricing
View Details
B Raf (BRAF) (NM_004333) Human Over-expression Lysate
LY401382 100 µg

B Raf (BRAF) (NM_004333) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Chloroacenaphthene
TRC-C367055-25MG 25 mg

1-Chloroacenaphthene

Sign In for Pricing
View Details