Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial, Biotinylated

This Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial, Biotinylated spans the amino acid sequence from region 76-212. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane domain-containing protein TMIGD3 TMIGD3 UNQ1931/PRO4406

UniProt

P0DMS9

Expression Region

76-212

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIN9 Antibody
orb422903-01 50 µg

LIN9 Antibody

Sign In for Pricing
View Details
LIN9 Antibody
orb422903-02 100 µg

LIN9 Antibody

Sign In for Pricing
View Details
NOS1/nNOS (Nitric Oxide Synthase 1, Neuronal) BioAssayTM ELISA Kit (Rat) discontinued
357646-01 48 Tests

NOS1/nNOS (Nitric Oxide Synthase 1, Neuronal) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
NOS1/nNOS (Nitric Oxide Synthase 1, Neuronal) BioAssayTM ELISA Kit (Rat) discontinued
357646-02 96 Tests

NOS1/nNOS (Nitric Oxide Synthase 1, Neuronal) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Chicken 2-amino-3-ketobutye coenzyme A ligase, mitochondrial (GCAT) ELISA Kit
MBS7208827-01 48 Well

Chicken 2-amino-3-ketobutye coenzyme A ligase, mitochondrial (GCAT) ELISA Kit

Sign In for Pricing
View Details
Chicken 2-amino-3-ketobutye coenzyme A ligase, mitochondrial (GCAT) ELISA Kit
MBS7208827-02 96 Well

Chicken 2-amino-3-ketobutye coenzyme A ligase, mitochondrial (GCAT) ELISA Kit

Sign In for Pricing
View Details