Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated
This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3
UniProt
P0DOY3
Expression Region
1-106
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1371198-01 0.02 mg (E-Coli)
Recombinant Ehrlichia ruminantium Putative phosphotransferase ERGA_CDS_02020 (ERGA_CDS_02020)
Sign In for Pricing
View Details MBS1371198-02 0.02 mg (Yeast)
Recombinant Ehrlichia ruminantium Putative phosphotransferase ERGA_CDS_02020 (ERGA_CDS_02020)
Sign In for Pricing
View Details MBS1371198-03 0.1 mg (E-Coli)
Recombinant Ehrlichia ruminantium Putative phosphotransferase ERGA_CDS_02020 (ERGA_CDS_02020)
Sign In for Pricing
View Details MBS1371198-04 0.1 mg (Yeast)
Recombinant Ehrlichia ruminantium Putative phosphotransferase ERGA_CDS_02020 (ERGA_CDS_02020)
Sign In for Pricing
View Details MBS1371198-05 0.02 mg (Baculovirus)
Recombinant Ehrlichia ruminantium Putative phosphotransferase ERGA_CDS_02020 (ERGA_CDS_02020)
Sign In for Pricing
View Details