Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC 9 Blocking Peptide
33R-10524 50 ug

HDAC 9 Blocking Peptide

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to AURKB
sAP-0089 50 µg

Mouse Monoclonal Antibody to AURKB

Sign In for Pricing
View Details
Printed, assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS
P50237R 1000 Units/Pack

Printed, assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
Weighing dishes, black, antistatic
1211759 500 PK

Weighing dishes, black, antistatic

Sign In for Pricing
View Details
LIN28B, NT (LIN28B, CSDD2, Protein lin-28 homolog B) (Azide free) (HRP)
MBS6316255-01 0.2 mL

LIN28B, NT (LIN28B, CSDD2, Protein lin-28 homolog B) (Azide free) (HRP)

Sign In for Pricing
View Details
LIN28B, NT (LIN28B, CSDD2, Protein lin-28 homolog B) (Azide free) (HRP)
MBS6316255-02 5x 0.2 mL

LIN28B, NT (LIN28B, CSDD2, Protein lin-28 homolog B) (Azide free) (HRP)

Sign In for Pricing
View Details