Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.Y (H3Y1), Biotinylated

This Recombinant Human Histone H3.Y (H3Y1), Biotinylated spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.Y; Histone H3.Y1; H3Y1

UniProt

P0DPK2

Expression Region

2-136

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal gp96/HSP90B1/GRP94 Antibody (9G10.F8.2) [Alexa Fluor 750]
NBP3-11511AF750 0.1 mL

Rat Monoclonal gp96/HSP90B1/GRP94 Antibody (9G10.F8.2) [Alexa Fluor 750]

Sign In for Pricing
View Details
Human CTBS Protein Lysate 20ug
IHUCTBSPLLY20UG 20 µg

Human CTBS Protein Lysate 20ug

Sign In for Pricing
View Details
GPR39 Rabbit Polyclonal Antibody
TA351234 100 µL

GPR39 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
anti-KIR2DL3
YF-PA12838 100 ug

anti-KIR2DL3

Sign In for Pricing
View Details
NDUS2 Polyclonal Antibody
UB-GEN-5669 100 µL

NDUS2 Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-5 ELISA Set
orb506574-01 5 x 96 T

Human IL-5 ELISA Set

Sign In for Pricing
View Details