Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.X (H3Y2), Biotinylated

This Recombinant Human Histone H3.X (H3Y2), Biotinylated spans the amino acid sequence from region 2-147. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.X; Histone H3.Y2; H3Y2

UniProt

P0DPK5

Expression Region

2-147

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV640523 1.0 µg DNA

LMO2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Bovine Alpha-Lactalbumin (aLA) ELISA Kit
DLR-aLA-b-48T 48 Tests

Bovine Alpha-Lactalbumin (aLA) ELISA Kit

Sign In for Pricing
View Details
Goat Mitochondrial import inner membrane translocase subunit Tim17 B (TIMM17B) ELISA kit
GTR10454614 96 Well

Goat Mitochondrial import inner membrane translocase subunit Tim17 B (TIMM17B) ELISA kit

Sign In for Pricing
View Details
Recombinant Human TNFAIP8L3 Protein
orb1906910 50 µg

Recombinant Human TNFAIP8L3 Protein

Sign In for Pricing
View Details
SCOC (NM_001153585) Human Tagged ORF Clone
RC228731 10 µg

SCOC (NM_001153585) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to YY1 Associated Factor 2 (YAF2)
MBS2067086-01 0.1 mL

PE-Linked Polyclonal Antibody to YY1 Associated Factor 2 (YAF2)

Sign In for Pricing
View Details