Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated

This Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1A; EC 3.2.1.1; 1,4-alpha-D-glucan glucanohydrolase 1; Salivary alpha-amylase; AMY1A AMY1

UniProt

P0DUB6

Expression Region

16-511

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd15 (BC079563) Mouse Tagged Lenti ORF Clone
MR211799L4 10 µg

Ankrd15 (BC079563) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-IL-1 beta Antibody
DL90586A-01 50 µL

Rabbit anti-IL-1 beta Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-1 beta Antibody
DL90586A-02 100 µL

Rabbit anti-IL-1 beta Antibody

Sign In for Pricing
View Details
Rosoxacin
BA1056-25 25 mg

Rosoxacin

Sign In for Pricing
View Details
Angiopoietin-Related Protein 3 (ANGPTL3) Antibody
abx457548-01 50 µg

Angiopoietin-Related Protein 3 (ANGPTL3) Antibody

Sign In for Pricing
View Details
Angiopoietin-Related Protein 3 (ANGPTL3) Antibody
abx457548-02 100 µg

Angiopoietin-Related Protein 3 (ANGPTL3) Antibody

Sign In for Pricing
View Details