Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine 5'-monophosphate synthase (UMPS), Biotinylated

This Recombinant Human Uridine 5'-monophosphate synthase (UMPS), Biotinylated spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uridine 5'-monophosphate synthase; UMP synthase; [Includes: Orotate phosphoribosyltransferase; OPRT; OPRTase; EC 2.4.2.10; Orotidine 5'-phosphate decarboxylase; ODC; OMPD; EC 4.1.1.23; OMPdecase] UMPS OK/SW-cl.21

UniProt

P11172

Expression Region

2-480

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2D22 Double Nickase Plasmid (m)
sc-425172-NIC 20 µg

CYP2D22 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Cyp2j6 3'UTR Lenti-reporter-Luc Vector
17427084 1.0 µg

Cyp2j6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PRMT3 Rabbit Polyclonal Antibody (Fluoro550)
orb3103172 100 µg

PRMT3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
(DANRE) gapdh Antibody (C-term)
orb1927112-01 50 µL

(DANRE) gapdh Antibody (C-term)

Sign In for Pricing
View Details
(DANRE) gapdh Antibody (C-term)
orb1927112-02 100 µL

(DANRE) gapdh Antibody (C-term)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL
BNC742094-100 1x 100 µL

P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details