Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial, Biotinylated

This Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial, Biotinylated spans the amino acid sequence from region 2-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycogen phosphorylase, muscle form; EC 2.4.1.1; Myophosphorylase; PYGM

UniProt

P11217

Expression Region

2-501

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam30 Mouse Gene Knockout Kit (CRISPR)
KN500835 1 Kit

Adam30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,4-Diamino-2-thiophenepentanoic Acid Dihydrochloride
TRC-D527910-5MG 5 mg

3,4-Diamino-2-thiophenepentanoic Acid Dihydrochloride

Sign In for Pricing
View Details
rac trans-Metconazole-d6
TRC-M225798-1MG 1 mg

rac trans-Metconazole-d6

Sign In for Pricing
View Details
FRMPD2 (NM_001018071) Human Over-expression Lysate
LC422722 20 µg

FRMPD2 (NM_001018071) Human Over-expression Lysate

Sign In for Pricing
View Details
Fibronectin Antibody
KC-6434-01 50 μL

Fibronectin Antibody

Sign In for Pricing
View Details
Fibronectin Antibody
KC-6434-02 100 µL

Fibronectin Antibody

Sign In for Pricing
View Details