Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B' (RSMB), Biotinylated

This Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B' (RSMB), Biotinylated spans the amino acid sequence from region 1-240. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small nuclear ribonucleoprotein-associated proteins B and B'; snRNP-B; Sm protein B/B'; Sm-B/B'; SmB/B'; SNRPB COD SNRPB1

UniProt

P14678

Expression Region

1-240

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0878507 1.0 µg DNA

GNL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Gc-Globulin (Vitamin D-binding Protein, DBP) Antibody (Biotin Conjugate)
12121-05021 150 µg

Human Gc-Globulin (Vitamin D-binding Protein, DBP) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Monarch Spin Plasmid Miniprep Kit
T1110L 250 Preparations

Monarch Spin Plasmid Miniprep Kit

Sign In for Pricing
View Details
Cytoplasmic dynein 1 heavy chain 1 Antibody (Fluoro550)
orb3165247 100 µg

Cytoplasmic dynein 1 heavy chain 1 Antibody (Fluoro550)

Sign In for Pricing
View Details
CPA1 Antibody
orb607241-01 20 µg

CPA1 Antibody

Sign In for Pricing
View Details
CPA1 Antibody
orb607241-02 100 µg

CPA1 Antibody

Sign In for Pricing
View Details