Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1), Biotinylated

This Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1), Biotinylated spans the amino acid sequence from region 2-514. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inosine-5'-monophosphate dehydrogenase 1; IMP dehydrogenase 1; IMPD 1; IMPDH 1; EC 1.1.1.205; IMPDH-I; IMPDH1 IMPD1

UniProt

P20839

Expression Region

2-514

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF1 Protein Vector (Human) (pPM-C-His)
PV075396 500 ng

ELF1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
DL-SDF1-Ra-01 48 Tests

Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
DL-SDF1-Ra-02 96 Tests

Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
Cyclin E1 (phospho Thr77) Polyclonal Antibody
ABP56920-01 30 µL

Cyclin E1 (phospho Thr77) Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E1 (phospho Thr77) Polyclonal Antibody
ABP56920-02 100 µL

Cyclin E1 (phospho Thr77) Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E1 (phospho Thr77) Polyclonal Antibody
ABP56920-03 200 µL

Cyclin E1 (phospho Thr77) Polyclonal Antibody

Sign In for Pricing
View Details