Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin B3 (SPB3), Biotinylated

This Recombinant Human Serpin B3 (SPB3), Biotinylated spans the amino acid sequence from region 1-390. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpin B3; Protein T4-A; Squamous cell carcinoma antigen 1; SCCA-1; SERPINB3 SCCA SCCA1

UniProt

P29508

Expression Region

1-390

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Bile duct
CS507971 5x 5 µm

Frozen Tissue Sections, Bile duct

Sign In for Pricing
View Details
CDHR3 Human qPCR Primer Pair (NM_152750)
HP217942 200 Reactions

CDHR3 Human qPCR Primer Pair (NM_152750)

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), 1mg/mL
BNUM0521-50 1x 50 µL

AFP (Alpha Fetoprotein) (MBS-12), 1mg/mL

Sign In for Pricing
View Details
ATP8B1 Human Gene Knockout Kit (CRISPR)
KN424841 1 Kit

ATP8B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF640R conjugate, 0.1mg/mL
BNC401779-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP5PF Human Gene Knockout Kit (CRISPR)
KN400691 1 Kit

ATP5PF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details