Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated
This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Myosin-binding protein C, slow-type; Slow MyBP-C; C-protein, skeletal muscle slow isoform; MYBPC1 MYBPCS
UniProt
Q00872
Expression Region
722-833
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550242-100 1x 100 µL
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942571-100 1x 100 µL
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
