Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 9 (IRF9), Biotinylated

This Recombinant Human Interferon regulatory factor 9 (IRF9), Biotinylated spans the amino acid sequence from region 1-393. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon regulatory factor 9; IRF-9; IFN-alpha-responsive transcription factor subunit; ISGF3 p48 subunit; Interferon-stimulated gene factor 3 gamma; ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma; IRF9 ISGF3G

UniProt

Q00978

Expression Region

1-393

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lyst shRNA Plasmid (h)
sc-88631-SH 20 µg

Lyst shRNA Plasmid (h)

Sign In for Pricing
View Details
{2-Aminobicyclo[2.2.2]octan-2-yl}methanol hydrochloride
TMD06451-01 50 mg

{2-Aminobicyclo[2.2.2]octan-2-yl}methanol hydrochloride

Sign In for Pricing
View Details
{2-Aminobicyclo[2.2.2]octan-2-yl}methanol hydrochloride
TMD06451-02 0.5 g

{2-Aminobicyclo[2.2.2]octan-2-yl}methanol hydrochloride

Sign In for Pricing
View Details
THSD1 Antibody - middle region : FITC (ARP49333_P050-FITC)
ARP49333_P050-FITC 100 µL

THSD1 Antibody - middle region : FITC (ARP49333_P050-FITC)

Sign In for Pricing
View Details
Adh7 Mouse shRNA Plasmid (Locus ID 11529)
TL513804 1 Kit

Adh7 Mouse shRNA Plasmid (Locus ID 11529)

Sign In for Pricing
View Details
FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (PE)
MBS6184738-01 0.1 mL

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (PE)

Sign In for Pricing
View Details