Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated
This Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated spans the amino acid sequence from region 2197-2307. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Spectrin beta chain, non-erythrocytic 1; Beta-II spectrin; Fodrin beta chain; Spectrin, non-erythroid beta chain 1; SPTBN1 SPTB2
UniProt
Q01082
Expression Region
2197-2307
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAIS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6462671-01 0.2 mL
AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6462671-02 5x 0.2 mL
AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (Azide free) (HRP)
Sign In for Pricing
View Details 
TRC-B692223-250MG 250 mg
6-Bromo-8-fluoro-2,4-dihydro-1,4-benzoxazin-3-one
Sign In for Pricing
View Details 
LV678971 1.0 µg DNA
CMAS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details