Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SET (SET), Biotinylated

This Recombinant Human Protein SET (SET), Biotinylated spans the amino acid sequence from region 2-290. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SET; HLA-DR-associated protein II; Inhibitor of granzyme A-activated DNase; IGAAD; PHAPII; Phosphatase 2A inhibitor I2PP2A; I-2PP2A; Template-activating factor I; TAF-I; SET

UniProt

Q01105

Expression Region

2-290

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS632141 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
DL-6-Hydroxy Norleucine
TRC-H948855-5G 5 g

DL-6-Hydroxy Norleucine

Sign In for Pricing
View Details
2410018L13Rik (BC063063) Mouse Tagged ORF Clone
MG200444 10 µg

2410018L13Rik (BC063063) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
alpha Adaptin (AP2A2) Human Gene Knockout Kit (CRISPR)
KN403018 1 Kit

alpha Adaptin (AP2A2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diallylmalonic Acid
TRC-D415970-250MG 250 mg

Diallylmalonic Acid

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein (His Tag)
PKSH032546-01 10 µg

Recombinant Human HMGB3 Protein (His Tag)

Sign In for Pricing
View Details