Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial, Biotinylated

This Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial, Biotinylated spans the amino acid sequence from region 151-180. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High affinity immunoglobulin epsilon receptor subunit beta; FcERI; Fc epsilon receptor I beta-chain; IgE Fc receptor subunit beta; Membrane-spanning 4-domains subfamily A member 2; MS4A2 APY FCER1B IGER

UniProt

Q01362

Expression Region

151-180

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLKKSLAYIHIHSCQKFFETKCFMASFSTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRF Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1975318 100 µL

SRF Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit
MBS8803887-01 48 Well

Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit
MBS8803887-02 96 Well

Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit
MBS8803887-03 5x 96 Well

Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit
MBS8803887-04 10x 96 Well

Human MEC (Mucosae Associated Epithelia Chemokine) ELISA Kit

Sign In for Pricing
View Details
GTF2H5 (1-71, His-tag) Human Protein
AR51702PU-S 100 µg

GTF2H5 (1-71, His-tag) Human Protein

Sign In for Pricing
View Details