Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated

This Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated spans the amino acid sequence from region 1-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 1; Cancer/testis antigen 78; CT78; TSPY1 TSPY

UniProt

Q01534

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTH Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-9515R-BF680-TR 20 µL

CTH Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ZNF790 Human Gene Knockout Kit (CRISPR)
KN408895 1 Kit

ZNF790 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BIN2 HDR Plasmid (m)
sc-437142-HDR 20 µg

BIN2 HDR Plasmid (m)

Sign In for Pricing
View Details
Phospho-RASGRF1 (Ser929) Rabbit Polyclonal Antibody (BF680)
orb2409575 100 µL

Phospho-RASGRF1 (Ser929) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CA6 Antibody
56-574 400 µL

CA6 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Smek1 Antibody [mFluor Violet 610 SE]
NBP2-98483MFV610 0.1 mL

Rabbit Polyclonal Smek1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details