Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated

This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U; IFITM3

UniProt

Q01628

Expression Region

1-57

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Plg (NM_008877) AAV Particle
MR210779A1V 250 µL

Mouse Plg (NM_008877) AAV Particle

Sign In for Pricing
View Details
Cis-Pellitorine
orb1479666 2 mg

Cis-Pellitorine

Sign In for Pricing
View Details
G3bp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4610806 1.0 µg DNA

G3bp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CaspSCREEN™ Flow Cytometric Apoptosis Detection Kit
K200-100 100 Assays

CaspSCREEN™ Flow Cytometric Apoptosis Detection Kit

Sign In for Pricing
View Details
PE anti-human CD44 variant 9 (CD44v9)
GT16467 100 Tests

PE anti-human CD44 variant 9 (CD44v9)

Sign In for Pricing
View Details
Rabbit Monoclonal PCPTP1 Antibody (JE64-84)
NBP3-32726 100 µL

Rabbit Monoclonal PCPTP1 Antibody (JE64-84)

Sign In for Pricing
View Details