Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 receptor-like 1 (ILRL1), partial, Biotinylated

This Recombinant Human Interleukin-1 receptor-like 1 (ILRL1), partial, Biotinylated spans the amino acid sequence from region 19-328. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-1 receptor-like 1; EC 3.2.2.6; Protein ST2; IL1RL1 DER4 ST2 T1

UniProt

Q01638

Expression Region

19-328

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Fluorophenyl) -1H-pyrrole-2-carboxaldehyde
sc-264530 1 g

1- (2-Fluorophenyl) -1H-pyrrole-2-carboxaldehyde

Sign In for Pricing
View Details
DFNB80 sgRNA CRISPR Lentivector (Human) (Target 3)
K0594304 1.0 µg DNA

DFNB80 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Bovine anti-sperm antibody, AsAb ELISA Kit
MBS7233740-01 48 Well

Bovine anti-sperm antibody, AsAb ELISA Kit

Sign In for Pricing
View Details
Bovine anti-sperm antibody, AsAb ELISA Kit
MBS7233740-02 96 Well

Bovine anti-sperm antibody, AsAb ELISA Kit

Sign In for Pricing
View Details
Bovine anti-sperm antibody, AsAb ELISA Kit
MBS7233740-03 5x 96 Well

Bovine anti-sperm antibody, AsAb ELISA Kit

Sign In for Pricing
View Details
Bovine anti-sperm antibody, AsAb ELISA Kit
MBS7233740-04 10x 96 Well

Bovine anti-sperm antibody, AsAb ELISA Kit

Sign In for Pricing
View Details