Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial, Biotinylated
This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial, Biotinylated spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH
UniProt
Q02221
Expression Region
50-97
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
032800 200 µL
C19orf50, ID (KXD1, C19orf50, KxDL motif-containing protein 1)
Sign In for Pricing
View Details 