Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated

This Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CentiMark PCR Marker (ready-to-use), 5 x 50µg
NM2420 5 x 50μg

CentiMark PCR Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
OSGIN2 Rabbit Polyclonal Antibody
TA371012 100 µL

OSGIN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC Conjugated Robinia pseudoacacia (Black Locust) -RPA-
R-4101-1 1 mg

TRITC Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details
Butyrylcholinesterase (BCHE) Human Gene Knockout Kit (CRISPR)
KN402198 1 Kit

Butyrylcholinesterase (BCHE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL
BNC041778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRHPR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]
TA502086AM 100 µL

GRHPR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details