Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H1.1 (H11), Biotinylated

This Recombinant Human Histone H1.1 (H11), Biotinylated spans the amino acid sequence from region 2-215. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1.1; Histone H1a; H1-1 H1F1 HIST1H1A

UniProt

Q02539

Expression Region

2-215

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif2a (NM_001005509) Mouse Tagged Lenti ORF Clone
MR209105L3 10 µg

Eif2a (NM_001005509) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
5-HT-1F Antibody
MBS9410718-01 0.05 mL

5-HT-1F Antibody

Sign In for Pricing
View Details
5-HT-1F Antibody
MBS9410718-02 0.1 mL

5-HT-1F Antibody

Sign In for Pricing
View Details
5-HT-1F Antibody
MBS9410718-03 5x 0.1 mL

5-HT-1F Antibody

Sign In for Pricing
View Details
SAMD12 CRISPR Activation Plasmid (h)
sc-407116-ACT 20 µg

SAMD12 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
5,11-Dihydrodibenzo[b, e][1,4]oxazepine
OR1057521-01 100 mg

5,11-Dihydrodibenzo[b, e][1,4]oxazepine

Sign In for Pricing
View Details