Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2), Biotinylated

This Recombinant Human Helix-loop-helix protein 2 (HEN2), Biotinylated spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF572 ORF Vector (Human) (pORF)
51628011 1.0 µg DNA

ZNF572 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cyp24a1 AAV siRNA Pooled Vector
17326164 1.0 µg

Cyp24a1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Ltb4r sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6764308 1.0 µg DNA

Ltb4r sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Poliovirus type 1 Genome polyprotein
MBS1029516-01 0.02 mg (E-Coli)

Recombinant Poliovirus type 1 Genome polyprotein

Sign In for Pricing
View Details
Recombinant Poliovirus type 1 Genome polyprotein
MBS1029516-02 0.02 mg (Yeast)

Recombinant Poliovirus type 1 Genome polyprotein

Sign In for Pricing
View Details
Recombinant Poliovirus type 1 Genome polyprotein
MBS1029516-03 0.1 mg (E-Coli)

Recombinant Poliovirus type 1 Genome polyprotein

Sign In for Pricing
View Details