Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), Biotinylated

This Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), Biotinylated spans the amino acid sequence from region 1-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; EC 4.2.3.12; PTS

UniProt

Q03393

Expression Region

1-145

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Seriniquinone
bs-75796C-01 1 mg

Seriniquinone

Sign In for Pricing
View Details
Seriniquinone
bs-75796C-02 5 mg

Seriniquinone

Sign In for Pricing
View Details
Mouse SYT1 (Synaptotagmin 1) Microsample ELISA Kit
orb2997264-01 48 Tests

Mouse SYT1 (Synaptotagmin 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse SYT1 (Synaptotagmin 1) Microsample ELISA Kit
orb2997264-02 96 Tests

Mouse SYT1 (Synaptotagmin 1) Microsample ELISA Kit

Sign In for Pricing
View Details
Rb Rabbit pAb, PerCP-Cy7 conjugated
orb2841218 100 µL

Rb Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Human S100A2 MAb (Clone 674033)
MAB48701 100 µg

Human S100A2 MAb (Clone 674033)

Sign In for Pricing
View Details