Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated

This Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®488A Conjugate - Biotium Choice
P038-488A-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®488A Conjugate - Biotium Choice

Sign In for Pricing
View Details
Diphenyl Phosphate-d10
TRC-D492002-1MG 1 mg

Diphenyl Phosphate-d10

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF740 conjugate, 0.1mg/mL
BNC742870-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
uronyl 2 suLfotransferase (UST) (NM_005715) Human Over-expression Lysate
LC401743 20 µg

uronyl 2 suLfotransferase (UST) (NM_005715) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc39a7 Mouse Gene Knockout Kit (CRISPR)
KN516111 1 Kit

Slc39a7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Benzyloxycarbonyl Nortropine
TRC-B286240-25MG 25 mg

N-Benzyloxycarbonyl Nortropine

Sign In for Pricing
View Details