Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated

This Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgA Immunoglobulin (IA761), Biotin conjugate, 0.1mg/mL
BNCB0761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,4'-Dichlorodiphenyltrichloroethane
TRC-D434205-10MG 10 mg

2,4'-Dichlorodiphenyltrichloroethane

Sign In for Pricing
View Details
Human TP53TG3D activation kit by CRISPRa
GA118997 1 Kit

Human TP53TG3D activation kit by CRISPRa

Sign In for Pricing
View Details
SERF2 (NM_001018108) Human Over-expression Lysate
LY422655 100 µg

SERF2 (NM_001018108) Human Over-expression Lysate

Sign In for Pricing
View Details
Ssbp4 Mouse Gene Knockout Kit (CRISPR)
KN516759 1 Kit

Ssbp4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DLX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA811644BM 100 µL

DLX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details