Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated

This Recombinant Human Alpha-actinin-3 (ACTN3), partial, Biotinylated spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal anti-mouse Intelectin-2
mAP-0454 50 µg

Rat Monoclonal anti-mouse Intelectin-2

Sign In for Pricing
View Details
EAAT1 (SLC1A3) (NM_001166695) Human Tagged ORF Clone
RC230179 10 µg

EAAT1 (SLC1A3) (NM_001166695) Human Tagged ORF Clone

Sign In for Pricing
View Details
JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (HRP)
128703-HRP 100 µL

JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (HRP)

Sign In for Pricing
View Details
PEBFP-LC3b
BZ20743 1 Vial

PEBFP-LC3b

Sign In for Pricing
View Details
Anti-Syndecan-1 Antibody-PE (1I989)
TMAY-01863P-01 25 Tests

Anti-Syndecan-1 Antibody-PE (1I989)

Sign In for Pricing
View Details
Anti-Syndecan-1 Antibody-PE (1I989)
TMAY-01863P-02 100 Tests

Anti-Syndecan-1 Antibody-PE (1I989)

Sign In for Pricing
View Details