Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial, Biotinylated
This Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial, Biotinylated spans the amino acid sequence from region 1349-1483. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Calmodulin-regulated spectrin-associated protein 2; Calmodulin-regulated spectrin-associated protein 1-like protein 1; CAMSAP2 CAMSAP1L1 KIAA1078
UniProt
Q08AD1
Expression Region
1349-1483
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal PKC iota Antibody (PRKCI/4911) [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP3-14155IR 0.1 mL
Mouse Monoclonal PKC iota Antibody (PRKCI/4911) [DyLight 755]
Sign In for Pricing
View Details 
VAng-Cr6452-1mgEcoli 1 mg (E. coli)
Recombinant Staphylococcus Aureus splD Protein (aa 37-239)
Sign In for Pricing
View Details 
A21063-10mM-D 10 mM x 1mL in DMSO
A2AR-agonist-1 10mM * 1mL in DMSO
Sign In for Pricing
View Details C2549-50P1 100 µg
CDC2 (Cell Division Protein Kinase 1, Cell Division Control Protein 2 Homolog, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, CDK1)
Sign In for Pricing
View Details