Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial, Biotinylated

This Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial, Biotinylated spans the amino acid sequence from region 320-356. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8 HRINS SUR SUR1

UniProt

Q09428

Expression Region

320-356

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Coagulation Factor VII (F7) ELISA Kit
RD-F7-Ra-96Tests 96 Tests

Rat Coagulation Factor VII (F7) ELISA Kit

Sign In for Pricing
View Details
Magic Touch 2 ice
1209812 1 Unit

Magic Touch 2 ice

Sign In for Pricing
View Details
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone Lentiviral Particle
RC224768L3V 200 µL

CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hmg1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6348205 3x 1.0 µg

Hmg1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
C17orf39 Protein Vector (Human) (pPM-N-D-C-His)
PV329289 500 ng

C17orf39 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Hexokinase 1 Recombinant Rabbit mAb
E53M01755 100 µL

Hexokinase 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details