Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 415 (ZN415), Biotinylated

This Recombinant Human Zinc finger protein 415 (ZN415), Biotinylated spans the amino acid sequence from region 1-603. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 415 ZNF415

UniProt

Q09FC8

Expression Region

1-603

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCENRLECNGAISAHCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKKIHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMTVRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKCYECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLATHQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKCNECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif3b Mouse Gene Knockout Kit (CRISPR)
KN505106 1 Kit

Eif3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chicken chenodeoxycholic acid ELISA kit
GTR10424767 96 Well

Chicken chenodeoxycholic acid ELISA kit

Sign In for Pricing
View Details
NDUFA13 Recombinant Monoclonal Antibody
RAC09099-01 50 µL

NDUFA13 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
NDUFA13 Recombinant Monoclonal Antibody
RAC09099-02 100 µL

NDUFA13 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
pECMV-Plxna1-m-FLAG Plasmid
PVT15551 2 µg

pECMV-Plxna1-m-FLAG Plasmid

Sign In for Pricing
View Details
VDAC1 antibody
70R-21247 50 ul

VDAC1 antibody

Sign In for Pricing
View Details