Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated

This Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MSH3 Knockout A549 cell line
GTR15403461 1 Vial

Human MSH3 Knockout A549 cell line

Sign In for Pricing
View Details
Rat ATR interacting protein (ATRIP) ELISA Kit
GTR10329310 96 Well

Rat ATR interacting protein (ATRIP) ELISA Kit

Sign In for Pricing
View Details
Anti-HEL mouse IgG2a-LALAPG-kappa isotype control
R1-264-100-01 100 µg

Anti-HEL mouse IgG2a-LALAPG-kappa isotype control

Sign In for Pricing
View Details
Anti-HEL mouse IgG2a-LALAPG-kappa isotype control
R1-264-100-02 500 µg

Anti-HEL mouse IgG2a-LALAPG-kappa isotype control

Sign In for Pricing
View Details
Anti-HEL mouse IgG2a-LALAPG-kappa isotype control
R1-264-100-03 1 mg

Anti-HEL mouse IgG2a-LALAPG-kappa isotype control

Sign In for Pricing
View Details
STYK1 Antibody
E51A13894 100 µL

STYK1 Antibody

Sign In for Pricing
View Details