Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2), Biotinylated spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RNF2 Antibody
NBP3-03455-100ul 100 µL

Rabbit Polyclonal RNF2 Antibody

Sign In for Pricing
View Details
C1orf91 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0209005 3x 1.0 µg

C1orf91 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF405S conjugate, 0.1mg/mL
BNC041409-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral human HMGN2 sgRNA gene knockout kit - Lentiviral human HMGN2 sgRNA gene knockout kit (100)
GTR15397747 1 Vial

Lentiviral human HMGN2 sgRNA gene knockout kit - Lentiviral human HMGN2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 490)
MBS6209352-01 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 490)

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 490)
MBS6209352-02 5x 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 490)

Sign In for Pricing
View Details