Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Periostin (POSTN), partial, Biotinylated

This Recombinant Human Periostin (POSTN), partial, Biotinylated spans the amino acid sequence from region 97-230. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Periostin; PN; Osteoblast-specific factor 2; OSF-2; POSTN OSF2

UniProt

Q15063

Expression Region

97-230

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCR2/IL-8 RB Alexa Fluor 750 Antibody (Clone 48311)
FAB331S-100UG 100 µg

Human CXCR2/IL-8 RB Alexa Fluor 750 Antibody (Clone 48311)

Sign In for Pricing
View Details
Alg11 (BC061469) Mouse Tagged ORF Clone Lentiviral Particle
MR204808L4V 200 µL

Alg11 (BC061469) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FHL2 Antibody (Biotin)
orb47626-01 50 µg

FHL2 Antibody (Biotin)

Sign In for Pricing
View Details
FHL2 Antibody (Biotin)
orb47626-02 100 µg

FHL2 Antibody (Biotin)

Sign In for Pricing
View Details
POU4F3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV623854 1.0 µg DNA

POU4F3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Cloprostenol Peptide (OVA)
abx165673-01 100 µg

Cloprostenol Peptide (OVA)

Sign In for Pricing
View Details