Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB), Biotinylated

This Recombinant Human SH2 domain-containing adapter protein B (SHB), Biotinylated spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T Cell Receptor (TCR) gamma/delta Hamster Monoclonal Antibody [Clone ID: UC7-13D5]
AM08059LE-N 500 µg

T Cell Receptor (TCR) gamma/delta Hamster Monoclonal Antibody [Clone ID: UC7-13D5]

Sign In for Pricing
View Details
Mmu-miR-7009-3p miRNA Inhibitor
CIM1490-01 10 nmol

Mmu-miR-7009-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7009-3p miRNA Inhibitor
CIM1490-02 20 nmol

Mmu-miR-7009-3p miRNA Inhibitor

Sign In for Pricing
View Details
8-Bromoadenine
440039-01 1 g

8-Bromoadenine

Sign In for Pricing
View Details
8-Bromoadenine
440039-02 10 g

8-Bromoadenine

Sign In for Pricing
View Details
HPV18 E6/Protein E6 Polyclonal Antibody
E55A02992 100 µg

HPV18 E6/Protein E6 Polyclonal Antibody

Sign In for Pricing
View Details